![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.20: Clc chloride channel [81341] (1 superfamily) core: 18 transmembrane helices |
![]() | Superfamily f.20.1: Clc chloride channel [81340] (1 family) ![]() |
![]() | Family f.20.1.1: Clc chloride channel [69912] (2 proteins) duplication: consist of two similar structural parts |
![]() | Protein automated matches [226846] (4 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [255156] (2 PDB entries) |
![]() | Domain d2exya_: 2exy A: [132572] Other proteins in same PDB: d2exyd1, d2exyd2, d2exyf1, d2exyf2 automated match to d1kpla_ mutant |
PDB Entry: 2exy (more details), 3.1 Å
SCOPe Domain Sequences for d2exya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exya_ f.20.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl gtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla qftggkplysailartlakqeaeq
Timeline for d2exya_: