Lineage for d2exya_ (2exy A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253242Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2253243Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2253244Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2253292Protein automated matches [226846] (4 species)
    not a true protein
  7. 2253324Species Escherichia coli [TaxId:562] [255156] (2 PDB entries)
  8. 2253327Domain d2exya_: 2exy A: [132572]
    Other proteins in same PDB: d2exyd1, d2exyd2, d2exyf1, d2exyf2
    automated match to d1kpla_
    mutant

Details for d2exya_

PDB Entry: 2exy (more details), 3.1 Å

PDB Description: Crystal structure of the E148Q Mutant of EcClC, Fab complexed in absence of bound ions
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2exya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exya_ f.20.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeaeq

SCOPe Domain Coordinates for d2exya_:

Click to download the PDB-style file with coordinates for d2exya_.
(The format of our PDB-style files is described here.)

Timeline for d2exya_: