Lineage for d2exwf2 (2exw F:107-210)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1761687Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1761919Species Mouse (Mus musculus) [TaxId:10090] [88567] (346 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 1762323Domain d2exwf2: 2exw F:107-210 [132571]
    Other proteins in same PDB: d2exwa1, d2exwb1, d2exwd1, d2exwf1
    automatically matched to d1dqdl2

Details for d2exwf2

PDB Entry: 2exw (more details), 3.2 Å

PDB Description: Crystal structure of a EcClC-Fab complex in the absence of bound ions
PDB Compounds: (F:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d2exwf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exwf2 b.1.1.2 (F:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d2exwf2:

Click to download the PDB-style file with coordinates for d2exwf2.
(The format of our PDB-style files is described here.)

Timeline for d2exwf2: