SCOPe 2.03: Domain d2exwb1: 2exw B:18-458

Lineage for d2exwb1 (2exw B:18-458)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.20: Clc chloride channel [81341] (1 superfamily)
   core: 18 transmembrane helices

4. Superfamily f.20.1: Clc chloride channel [81340] (1 family)

5. Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
   duplication: consist of two similar structural parts

6. Protein Clc chloride channel [69913] (2 species)

7. Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)

8. Domain d2exwb1: 2exw B:18-458 [132567]
   Other proteins in same PDB: d2exwd1, d2exwd2, d2exwf1, d2exwf2
   automatically matched to d1kpka_

Details for d2exwb1

PDB Entry: 2exw, 3.2 Å

PDB Description: Crystal structure of a EcClC-Fab complex in the absence of bound ions

PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2exwb1:

Sequence; same for both SEQRES and ATOM records:

>d2exwb1 f.20.1.1 (B:18-458) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

Timeline for d2exwb1:

• d2exwb1 first appeared in SCOP 1.73
  
• d2exwb1 appears in SCOPe 2.02
  
• d2exwb1 appears in SCOPe 2.04
  
• d2exwb1 appears in the current release, SCOPe 2.08