SCOPe 2.08: Domain d2extb_: 2ext B:

Lineage for d2extb_ (2ext B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.5: TRAP-like [51219] (2 families)
   shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains

5. Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins)
   oligomeric ring consists of 11 single-domain subunits
   automatically mapped to Pfam PF02081

6. Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51223] (11 PDB entries)

8. Domain d2extb_: 2ext B: [132564]
   automated match to d1c9sm_
   complexed with trp

Details for d2extb_

PDB Entry: 2ext, 1.8 Å

PDB Description: TRAP4 (engineered TRAP)

PDB Compounds: (B:) transcription attenuation protein mtrb

SCOPe Domain Sequences for d2extb_:

Sequence; same for both SEQRES and ATOM records:

>d2extb_ b.82.5.1 (B:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]}
sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
hgvies

Timeline for d2extb_:

• d2extb_ first appeared in SCOP 1.73, called d2extb1
  
• d2extb_ appears in SCOPe 2.07