Class b: All beta proteins [48724] (165 folds) |
Fold b.165: MOSC N-terminal domain-like [141672] (1 superfamily) complex fold; comprises a beta-hairpin and a meander 3-stranded sheet packed against beta-barrel: closed, n=5, S=8; contains three short helices |
Superfamily b.165.1: MOSC N-terminal domain-like [141673] (1 family) |
Family b.165.1.1: MOSC N-terminal domain-like [141674] (1 protein) Pfam PF03476 |
Protein Hypothetical protein BB0938 [141675] (1 species) |
Species Bordetella bronchiseptica [TaxId:518] [141676] (1 PDB entry) |
Domain d2exna1: 2exn A:1-128 [132562] |
PDB Entry: 2exn (more details)
SCOP Domain Sequences for d2exna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exna1 b.165.1.1 (A:1-128) Hypothetical protein BB0938 {Bordetella bronchiseptica [TaxId: 518]} msttayqpiaecgattqseaaayqkrwlvandagqwlnrdlcprlaevsvelrmgylvlk apgmlrldipldviedddsvryqmlvgeqtvdvvdegelaaawisnhagvpcrilkvhpd maevrwps
Timeline for d2exna1: