Lineage for d2exlb1 (2exl B:74-337)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732553Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 732554Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 732555Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein)
  6. 732556Protein HSP90 [55876] (3 species)
  7. 732575Species Dog (Canis familiaris) [TaxId:9615] [103225] (20 PDB entries)
  8. 732605Domain d2exlb1: 2exl B:74-337 [132560]
    automatically matched to d1u2oa_
    complexed with 1pe, gmy, pg4; mutant

Details for d2exlb1

PDB Entry: 2exl (more details), 2.35 Å

PDB Description: grp94 n-terminal domain bound to geldanamycin
PDB Compounds: (B:) Endoplasmin

SCOP Domain Sequences for d2exlb1:

Sequence, based on SEQRES records: (download)

>d2exlb1 d.122.1.1 (B:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneelt
vkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstselig
qfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlke
easdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d2exlb1 d.122.1.1 (B:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneelt
vkikcdkeknllhvtdtgvgmtreelvknlgtistseligqfgvgfysaflvadkvivts
khnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyleldtiknlvkkysq
finfpiyvwssktktvwdwelmn

SCOP Domain Coordinates for d2exlb1:

Click to download the PDB-style file with coordinates for d2exlb1.
(The format of our PDB-style files is described here.)

Timeline for d2exlb1:

Domains from other chains:
(mouse over for more information)
d2exla1