Lineage for d2exla1 (2exl A:72-337)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871740Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 871741Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 871742Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein)
  6. 871743Protein HSP90 [55876] (3 species)
  7. 871767Species Dog (Canis familiaris) [TaxId:9615] [103225] (20 PDB entries)
    Uniprot P41148 76-285; Endoplasmin, GRP94
  8. 871797Domain d2exla1: 2exl A:72-337 [132559]
    automatically matched to d1u2oa_
    complexed with 1pe, gmy, pg4; mutant

Details for d2exla1

PDB Entry: 2exl (more details), 2.35 Å

PDB Description: grp94 n-terminal domain bound to geldanamycin
PDB Compounds: (A:) Endoplasmin

SCOP Domain Sequences for d2exla1:

Sequence, based on SEQRES records: (download)

>d2exla1 d.122.1.1 (A:72-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagnee
ltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstsel
igqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvl
keeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d2exla1 d.122.1.1 (A:72-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagnee
ltvkikcdkeknllhvtdtgvgmtreelvknlgtiastseligqfgvgfysaflvadkvi
vtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyleldtiknlvkk
ysqfinfpiyvwssktktvwdwelmn

SCOP Domain Coordinates for d2exla1:

Click to download the PDB-style file with coordinates for d2exla1.
(The format of our PDB-style files is described here.)

Timeline for d2exla1: