Lineage for d2exkc2 (2exk C:3-324)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807084Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 807090Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) (S)
  5. 807091Family b.67.2.1: alpha-L-arabinanase-like [75006] (4 proteins)
  6. 807105Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
  7. 807123Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries)
    Uniprot Q68HB3 3-324
  8. 807130Domain d2exkc2: 2exk C:3-324 [132556]
    Other proteins in same PDB: d2exka1, d2exkb1, d2exkc1, d2exkd1
    automatically matched to 2EXK A:3-324
    complexed with ca, gol, mes, xys; mutant

Details for d2exkc2

PDB Entry: 2exk (more details), 2.2 Å

PDB Description: structure of the family43 beta-xylosidase e187g from geobacillus stearothermophilus in complex with xylobiose
PDB Compounds: (C:) beta-D-xylosidase

SCOP Domain Sequences for d2exkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exkc2 b.67.2.1 (C:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
lritggphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
yvvggngpsleidgpsveevsw

SCOP Domain Coordinates for d2exkc2:

Click to download the PDB-style file with coordinates for d2exkc2.
(The format of our PDB-style files is described here.)

Timeline for d2exkc2: