![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) ![]() |
![]() | Family b.67.2.1: alpha-L-arabinanase-like [75006] (4 proteins) |
![]() | Protein Beta-D-xylosidase N-terminal domain [141538] (4 species) |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries) |
![]() | Domain d2exkb2: 2exk B:3-324 [132554] Other proteins in same PDB: d2exka1, d2exkb1, d2exkc1, d2exkd1 automatically matched to 2EXK A:3-324 complexed with ca, gol, mes, xys; mutant |
PDB Entry: 2exk (more details), 2.2 Å
SCOP Domain Sequences for d2exkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exkb2 b.67.2.1 (B:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]} kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd lritggphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp yvvggngpsleidgpsveevsw
Timeline for d2exkb2: