![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) ![]() |
![]() | Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins) automatically mapped to Pfam PF04616 |
![]() | Protein Beta-D-xylosidase N-terminal domain [141538] (4 species) |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries) Uniprot Q68HB3 3-324 |
![]() | Domain d2exjd2: 2exj D:3-324 [132550] Other proteins in same PDB: d2exja1, d2exjb1, d2exjc1, d2exjd1 automated match to d2exja2 complexed with ca, gol, mes; mutant |
PDB Entry: 2exj (more details), 2.2 Å
SCOPe Domain Sequences for d2exjd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exjd2 b.67.2.1 (D:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]} kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl nssgfgpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp yvvggngpsleidgpsveevsw
Timeline for d2exjd2: