SCOPe 2.08: Domain d2exjd2: 2exj D:3-324

Lineage for d2exjd2 (2exj D:3-324)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
   automatically mapped to Pfam PF04616

6. Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)

7. Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries)
   Uniprot Q68HB3 3-324

8. Domain d2exjd2: 2exj D:3-324 [132550]
   Other proteins in same PDB: d2exja1, d2exjb1, d2exjc1, d2exjd1
   automated match to d2exja2
   complexed with ca, gol, mes; mutant

Details for d2exjd2

PDB Entry: 2exj, 2.2 Å

PDB Description: structure of the family43 beta-xylosidase d128g mutant from geobacillus stearothermophilus in complex with xylobiose

PDB Compounds: (D:) beta-D-xylosidase

SCOPe Domain Sequences for d2exjd2:

Sequence; same for both SEQRES and ATOM records:

>d2exjd2 b.67.2.1 (D:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
nssgfgpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
yvvggngpsleidgpsveevsw

Timeline for d2exjd2:

• d2exjd2 first appeared in SCOP 1.73
  
• d2exjd2 appears in SCOPe 2.07