Lineage for d2exjd1 (2exj D:325-535)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781763Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)
  6. 1781764Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)
  7. 1781782Species Geobacillus stearothermophilus [TaxId:1422] [141165] (4 PDB entries)
    Uniprot Q68HB3 325-535
  8. 1781798Domain d2exjd1: 2exj D:325-535 [132549]
    Other proteins in same PDB: d2exja2, d2exjb2, d2exjc2, d2exjd2
    automated match to d2exja1
    complexed with ca, gol, mes; mutant

Details for d2exjd1

PDB Entry: 2exj (more details), 2.2 Å

PDB Description: structure of the family43 beta-xylosidase d128g mutant from geobacillus stearothermophilus in complex with xylobiose
PDB Compounds: (D:) beta-D-xylosidase

SCOPe Domain Sequences for d2exjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exjd1 b.29.1.23 (D:325-535) Beta-D-xylosidase C-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
ekdydekddfdgdtlnhhfqtlriplgediatlkarpghlrlygresltsrftqafvarr
wqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlqitwheekgrilelmtcdhlvvd
qplrgreivvpddieyvylrvtvqattykysysfdgmnwidlpvtfesyklsddyiksra
aftgafvgmhcrdgsgqnnyadfdyflykel

SCOPe Domain Coordinates for d2exjd1:

Click to download the PDB-style file with coordinates for d2exjd1.
(The format of our PDB-style files is described here.)

Timeline for d2exjd1: