Lineage for d2exjc2 (2exj C:3-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807321Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2807331Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2807332Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 2807346Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
  7. 2807364Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries)
    Uniprot Q68HB3 3-324
  8. 2807375Domain d2exjc2: 2exj C:3-324 [132548]
    Other proteins in same PDB: d2exja1, d2exjb1, d2exjc1, d2exjd1
    automated match to d2exja2
    complexed with ca, gol, mes; mutant

Details for d2exjc2

PDB Entry: 2exj (more details), 2.2 Å

PDB Description: structure of the family43 beta-xylosidase d128g mutant from geobacillus stearothermophilus in complex with xylobiose
PDB Compounds: (C:) beta-D-xylosidase

SCOPe Domain Sequences for d2exjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exjc2 b.67.2.1 (C:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
nssgfgpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
yvvggngpsleidgpsveevsw

SCOPe Domain Coordinates for d2exjc2:

Click to download the PDB-style file with coordinates for d2exjc2.
(The format of our PDB-style files is described here.)

Timeline for d2exjc2: