Lineage for d2exjb2 (2exj B:3-324)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802003Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 1802009Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 1802010Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 1802024Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
  7. 1802042Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries)
    Uniprot Q68HB3 3-324
  8. 1802056Domain d2exjb2: 2exj B:3-324 [132546]
    Other proteins in same PDB: d2exja1, d2exjb1, d2exjc1, d2exjd1
    automated match to d2exja2
    complexed with ca, gol, mes; mutant

Details for d2exjb2

PDB Entry: 2exj (more details), 2.2 Å

PDB Description: structure of the family43 beta-xylosidase d128g mutant from geobacillus stearothermophilus in complex with xylobiose
PDB Compounds: (B:) beta-D-xylosidase

SCOPe Domain Sequences for d2exjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exjb2 b.67.2.1 (B:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
nssgfgpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
yvvggngpsleidgpsveevsw

SCOPe Domain Coordinates for d2exjb2:

Click to download the PDB-style file with coordinates for d2exjb2.
(The format of our PDB-style files is described here.)

Timeline for d2exjb2: