Lineage for d2exjb1 (2exj B:325-535)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)
  6. Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)
  7. Species Geobacillus stearothermophilus [TaxId:1422] [141165] (4 PDB entries)
    Uniprot Q68HB3 325-535
  8. Domain d2exjb1: 2exj B:325-535 [132545]
    Other proteins in same PDB: d2exja2, d2exjb2, d2exjc2, d2exjd2
    automated match to d2exja1
    complexed with ca, gol, mes; mutant

Details for d2exjb1

PDB Entry: 2exj (more details), 2.2 Å

PDB Description: structure of the family43 beta-xylosidase d128g mutant from geobacillus stearothermophilus in complex with xylobiose
PDB Compounds: (B:) beta-D-xylosidase

SCOPe Domain Sequences for d2exjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exjb1 b.29.1.23 (B:325-535) Beta-D-xylosidase C-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
ekdydekddfdgdtlnhhfqtlriplgediatlkarpghlrlygresltsrftqafvarr
wqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlqitwheekgrilelmtcdhlvvd
qplrgreivvpddieyvylrvtvqattykysysfdgmnwidlpvtfesyklsddyiksra
aftgafvgmhcrdgsgqnnyadfdyflykel

SCOPe Domain Coordinates for d2exjb1 are not available.

Timeline for d2exjb1:

Domains from same chain:
(mouse over for more information)
d2exjb2
Domains from other chains:
(mouse over for more information)
d2exja1, d2exja2, d2exjc1, d2exjc2, d2exjd1, d2exjd2