SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2exic2 (2exi C:3-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064801Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2064807Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2064808Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 protein domains)
    automatically mapped to Pfam PF04616
  6. 2064822Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
  7. 2064840Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries)
    Uniprot Q68HB3 3-324
  8. 2064851Domain d2exic2: 2exi C:3-324 [132540]
    Other proteins in same PDB: d2exia1, d2exib1, d2exic1, d2exid1
    automated match to d2exia2
    complexed with ca, gol, mes; mutant

Details for d2exic2

PDB Entry: 2exi (more details), 2.15 Å

PDB Description: Structure of the family43 beta-Xylosidase D15G mutant from geobacillus stearothermophilus
PDB Compounds: (C:) beta-D-xylosidase

SCOPe Domain Sequences for d2exic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exic2 b.67.2.1 (C:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
kiknpiltgfhpgpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
yvvggngpsleidgpsveevsw

SCOPe Domain Coordinates for d2exic2:

Click to download the PDB-style file with coordinates for d2exic2.
(The format of our PDB-style files is described here.)

Timeline for d2exic2: