Lineage for d2exic2 (2exi C:3-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064801Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2064807Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2064808Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 protein domains)
    automatically mapped to Pfam PF04616
  6. 2064822Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
  7. 2064840Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries)
    Uniprot Q68HB3 3-324
  8. 2064851Domain d2exic2: 2exi C:3-324 [132540]
    Other proteins in same PDB: d2exia1, d2exib1, d2exic1, d2exid1
    automated match to d2exia2
    complexed with ca, gol, mes; mutant

Details for d2exic2

PDB Entry: 2exi (more details), 2.15 Å

PDB Description: Structure of the family43 beta-Xylosidase D15G mutant from geobacillus stearothermophilus
PDB Compounds: (C:) beta-D-xylosidase

SCOPe Domain Sequences for d2exic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exic2 b.67.2.1 (C:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
kiknpiltgfhpgpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
yvvggngpsleidgpsveevsw

SCOPe Domain Coordinates for d2exic2:

Click to download the PDB-style file with coordinates for d2exic2.
(The format of our PDB-style files is described here.)

Timeline for d2exic2: