Class b: All beta proteins [48724] (176 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) |
Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins) automatically mapped to Pfam PF04616 |
Protein Beta-D-xylosidase N-terminal domain [141538] (4 species) |
Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries) Uniprot Q68HB3 3-324 |
Domain d2exia2: 2exi A:3-324 [132536] Other proteins in same PDB: d2exia1, d2exib1, d2exic1, d2exid1 complexed with ca, gol, mes; mutant |
PDB Entry: 2exi (more details), 2.15 Å
SCOPe Domain Sequences for d2exia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exia2 b.67.2.1 (A:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]} kiknpiltgfhpgpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp yvvggngpsleidgpsveevsw
Timeline for d2exia2: