![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein) |
![]() | Protein Beta-D-xylosidase C-terminal domain [141162] (4 species) |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [141165] (4 PDB entries) Uniprot Q68HB3 325-535 |
![]() | Domain d2exia1: 2exi A:325-535 [132535] Other proteins in same PDB: d2exia2, d2exib2, d2exic2, d2exid2 complexed with ca, gol, mes; mutant |
PDB Entry: 2exi (more details), 2.15 Å
SCOPe Domain Sequences for d2exia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exia1 b.29.1.23 (A:325-535) Beta-D-xylosidase C-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]} ekdydekddfdgdtlnhhfqtlriplgediatlkarpghlrlygresltsrftqafvarr wqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlqitwheekgrilelmtcdhlvvd qplrgreivvpddieyvylrvtvqattykysysfdgmnwidlpvtfesyklsddyiksra aftgafvgmhcrdgsgqnnyadfdyflykel
Timeline for d2exia1: