SCOPe 2.08: Domain d2exhd1: 2exh D:325-535

Lineage for d2exhd1 (2exh D:325-535)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)

6. Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)

7. Species Geobacillus stearothermophilus [TaxId:1422] [141165] (4 PDB entries)
   Uniprot Q68HB3 325-535

8. Domain d2exhd1: 2exh D:325-535 [132533]
   Other proteins in same PDB: d2exha2, d2exhb2, d2exhc2, d2exhd2
   automated match to d2exha1
   complexed with ca, gol, mes

Details for d2exhd1

PDB Entry: 2exh, 1.88 Å

PDB Description: structure of the family43 beta-xylosidase from geobacillus stearothermophilus

PDB Compounds: (D:) beta-D-xylosidase

SCOPe Domain Sequences for d2exhd1:

Sequence; same for both SEQRES and ATOM records:

>d2exhd1 b.29.1.23 (D:325-535) Beta-D-xylosidase C-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
ekdydekddfdgdtlnhhfqtlriplgediatlkarpghlrlygresltsrftqafvarr
wqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlqitwheekgrilelmtcdhlvvd
qplrgreivvpddieyvylrvtvqattykysysfdgmnwidlpvtfesyklsddyiksra
aftgafvgmhcrdgsgqnnyadfdyflykel

Timeline for d2exhd1:

• d2exhd1 first appeared in SCOP 1.73
  
• d2exhd1 appears in SCOPe 2.07