Class b: All beta proteins [48724] (165 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) |
Family b.67.2.1: alpha-L-arabinanase-like [75006] (4 proteins) |
Protein Beta-D-xylosidase N-terminal domain [141538] (4 species) |
Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries) |
Domain d2exhc2: 2exh C:3-324 [132532] Other proteins in same PDB: d2exha1, d2exhb1, d2exhc1, d2exhd1 automatically matched to 2EXH A:3-324 complexed with ca, gol, mes |
PDB Entry: 2exh (more details), 1.88 Å
SCOP Domain Sequences for d2exhc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exhc2 b.67.2.1 (C:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]} kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp yvvggngpsleidgpsveevsw
Timeline for d2exhc2: