SCOPe 2.06: Domain d2exhb2: 2exh B:3-324

Lineage for d2exhb2 (2exh B:3-324)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
   automatically mapped to Pfam PF04616

6. Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)

7. Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries)
   Uniprot Q68HB3 3-324

8. Domain d2exhb2: 2exh B:3-324 [132530]
   Other proteins in same PDB: d2exha1, d2exhb1, d2exhc1, d2exhd1
   automated match to d2exha2
   complexed with ca, gol, mes

Details for d2exhb2

PDB Entry: 2exh, 1.88 Å

PDB Description: structure of the family43 beta-xylosidase from geobacillus stearothermophilus

PDB Compounds: (B:) beta-D-xylosidase

SCOPe Domain Sequences for d2exhb2:

Sequence; same for both SEQRES and ATOM records:

>d2exhb2 b.67.2.1 (B:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
yvvggngpsleidgpsveevsw

Timeline for d2exhb2:

• d2exhb2 first appeared in SCOP 1.73
  
• d2exhb2 appears in SCOPe 2.05
  
• d2exhb2 appears in SCOPe 2.07
  
• d2exhb2 appears in the current release, SCOPe 2.08