Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein) |
Protein Beta-D-xylosidase C-terminal domain [141162] (4 species) |
Species Geobacillus stearothermophilus [TaxId:1422] [141165] (4 PDB entries) Uniprot Q68HB3 325-535 |
Domain d2exhb1: 2exh B:325-535 [132529] Other proteins in same PDB: d2exha2, d2exhb2, d2exhc2, d2exhd2 automated match to d2exha1 complexed with ca, gol, mes |
PDB Entry: 2exh (more details), 1.88 Å
SCOPe Domain Sequences for d2exhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exhb1 b.29.1.23 (B:325-535) Beta-D-xylosidase C-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]} ekdydekddfdgdtlnhhfqtlriplgediatlkarpghlrlygresltsrftqafvarr wqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlqitwheekgrilelmtcdhlvvd qplrgreivvpddieyvylrvtvqattykysysfdgmnwidlpvtfesyklsddyiksra aftgafvgmhcrdgsgqnnyadfdyflykel
Timeline for d2exhb1: