![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) ![]() |
![]() | Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins) automatically mapped to Pfam PF04616 |
![]() | Protein Beta-D-xylosidase N-terminal domain [141538] (4 species) |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries) Uniprot Q68HB3 3-324 |
![]() | Domain d2exha2: 2exh A:3-324 [132528] Other proteins in same PDB: d2exha1, d2exhb1, d2exhc1, d2exhd1 complexed with ca, gol, mes |
PDB Entry: 2exh (more details), 1.88 Å
SCOPe Domain Sequences for d2exha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exha2 b.67.2.1 (A:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]} kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp yvvggngpsleidgpsveevsw
Timeline for d2exha2: