Lineage for d2exha2 (2exh A:3-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807321Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2807331Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2807332Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 2807346Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
  7. 2807364Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries)
    Uniprot Q68HB3 3-324
  8. 2807365Domain d2exha2: 2exh A:3-324 [132528]
    Other proteins in same PDB: d2exha1, d2exhb1, d2exhc1, d2exhd1
    complexed with ca, gol, mes

Details for d2exha2

PDB Entry: 2exh (more details), 1.88 Å

PDB Description: structure of the family43 beta-xylosidase from geobacillus stearothermophilus
PDB Compounds: (A:) beta-D-xylosidase

SCOPe Domain Sequences for d2exha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exha2 b.67.2.1 (A:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
lritegphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
yvvggngpsleidgpsveevsw

SCOPe Domain Coordinates for d2exha2:

Click to download the PDB-style file with coordinates for d2exha2.
(The format of our PDB-style files is described here.)

Timeline for d2exha2: