Lineage for d2exfa1 (2exf A:12-53)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750654Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. 750655Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 750656Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (5 proteins)
  6. 750660Protein HIV nucleocapsid [57760] (2 species)
    duplication: two similar zinc-binding motifs
  7. 750661Species Human immunodeficiency virus type 1, different isolates [TaxId:11676] [57761] (12 PDB entries)
  8. 750663Domain d2exfa1: 2exf A:12-53 [132525]
    automatically matched to d1bj6a_
    complexed with zn

Details for d2exfa1

PDB Entry: 2exf (more details)

PDB Description: solution structure of the hiv-1 nucleocapsid (ncp7(12-55)) complexed with the dna (-) primer binding site
PDB Compounds: (A:) Nucleocapsid protein* (NC*)

SCOP Domain Sequences for d2exfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]}
nvkcfncgkeghtarncraprkkgcwkcgkeghqmkdcterq

SCOP Domain Coordinates for d2exfa1:

Click to download the PDB-style file with coordinates for d2exfa1.
(The format of our PDB-style files is described here.)

Timeline for d2exfa1: