![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily) metal(zinc)-bound fold |
![]() | Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) ![]() |
![]() | Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (5 proteins) |
![]() | Protein HIV nucleocapsid [57760] (2 species) duplication: two similar zinc-binding motifs |
![]() | Species Human immunodeficiency virus type 1, different isolates [TaxId:11676] [57761] (12 PDB entries) |
![]() | Domain d2exfa1: 2exf A:12-53 [132525] automatically matched to d1bj6a_ complexed with zn |
PDB Entry: 2exf (more details)
SCOP Domain Sequences for d2exfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} nvkcfncgkeghtarncraprkkgcwkcgkeghqmkdcterq
Timeline for d2exfa1: