SCOPe 2.08: Domain d2exfa1: 2exf A:13-53

Lineage for d2exfa1 (2exf A:13-53)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
   metal(zinc)-bound fold

4. Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family)

5. Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins)

6. Protein HIV nucleocapsid [57760] (2 species)
   duplication: two similar zinc-binding motifs

7. Species Human immunodeficiency virus type 1, different isolates [TaxId:11676] [57761] (12 PDB entries)
   Uniprot P03350 389-429

8. Domain d2exfa1: 2exf A:13-53 [132525]
   Other proteins in same PDB: d2exfa2
   automatically matched to d1bj6a_
   protein/DNA complex; complexed with zn

Details for d2exfa1

PDB Entry: 2exf

PDB Description: solution structure of the hiv-1 nucleocapsid (ncp7(12-55)) complexed with the dna (-) primer binding site

PDB Compounds: (A:) Nucleocapsid protein* (NC*)

SCOPe Domain Sequences for d2exfa1:

Sequence; same for both SEQRES and ATOM records:

>d2exfa1 g.40.1.1 (A:13-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]}
vkcfncgkeghtarncraprkkgcwkcgkeghqmkdcterq

Timeline for d2exfa1:

• d2exfa1 first appeared in SCOP 1.73
  
• d2exfa1 appears in SCOPe 2.07