Lineage for d2exda1 (2exd A:72-143)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 800592Superfamily b.40.12: NfeD domain-like [141322] (1 family) (S)
    close structural similarity to some members of the Nucleic acid-binding OB-fold proteins, possibly related to this superfamily
  5. 800593Family b.40.12.1: NfeD domain-like [141323] (1 protein)
    C-terminal part of Pfam PF01957
  6. 800594Protein Hypothetical protein PH0471 [141324] (1 species)
    NfeD short homolog
  7. 800595Species Pyrococcus horikoshii [TaxId:53953] [141325] (1 PDB entry)
    Uniprot O58204 72-143
  8. 800596Domain d2exda1: 2exd A:72-143 [132524]

Details for d2exda1

PDB Entry: 2exd (more details)

PDB Description: The solution structure of the C-terminal domain of a nfeD homolog from Pyrococcus horikoshii
PDB Compounds: (A:) nfeD short homolog

SCOP Domain Sequences for d2exda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exda1 b.40.12.1 (A:72-143) Hypothetical protein PH0471 {Pyrococcus horikoshii [TaxId: 53953]}
rrettdigggkytfelkgkvgkvvkiaedhylvevegdkwiaysdeklslgdrvmvvdvd
glklkvkrippq

SCOP Domain Coordinates for d2exda1:

Click to download the PDB-style file with coordinates for d2exda1.
(The format of our PDB-style files is described here.)

Timeline for d2exda1: