![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.12: NfeD domain-like [141322] (1 family) ![]() close structural similarity to some members of the Nucleic acid-binding OB-fold proteins, possibly related to this superfamily automatically mapped to Pfam PF01957 |
![]() | Family b.40.12.1: NfeD domain-like [141323] (1 protein) C-terminal part of Pfam PF01957 |
![]() | Protein Hypothetical protein PH0471 [141324] (1 species) NfeD short homolog |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [141325] (1 PDB entry) Uniprot O58204 72-143 |
![]() | Domain d2exda1: 2exd A:72-143 [132524] Other proteins in same PDB: d2exda2 |
PDB Entry: 2exd (more details)
SCOPe Domain Sequences for d2exda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exda1 b.40.12.1 (A:72-143) Hypothetical protein PH0471 {Pyrococcus horikoshii [TaxId: 53953]} rrettdigggkytfelkgkvgkvvkiaedhylvevegdkwiaysdeklslgdrvmvvdvd glklkvkrippq
Timeline for d2exda1: