SCOPe 2.07: Domain d2exda1: 2exd A:72-143

Lineage for d2exda1 (2exd A:72-143)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.12: NfeD domain-like [141322] (1 family)
   close structural similarity to some members of the Nucleic acid-binding OB-fold proteins, possibly related to this superfamily
   automatically mapped to Pfam PF01957

5. Family b.40.12.1: NfeD domain-like [141323] (1 protein)
   C-terminal part of Pfam PF01957

6. Protein Hypothetical protein PH0471 [141324] (1 species)
   NfeD short homolog

7. Species Pyrococcus horikoshii [TaxId:53953] [141325] (1 PDB entry)
   Uniprot O58204 72-143

8. Domain d2exda1: 2exd A:72-143 [132524]
   Other proteins in same PDB: d2exda2

Details for d2exda1

PDB Entry: 2exd

PDB Description: The solution structure of the C-terminal domain of a nfeD homolog from Pyrococcus horikoshii

PDB Compounds: (A:) nfeD short homolog

SCOPe Domain Sequences for d2exda1:

Sequence; same for both SEQRES and ATOM records:

>d2exda1 b.40.12.1 (A:72-143) Hypothetical protein PH0471 {Pyrococcus horikoshii [TaxId: 53953]}
rrettdigggkytfelkgkvgkvvkiaedhylvevegdkwiaysdeklslgdrvmvvdvd
glklkvkrippq

Timeline for d2exda1:

• d2exda1 first appeared in SCOP 1.73
  
• d2exda1 appears in SCOPe 2.06