Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein c-jun N-terminal kinase (jnk3s) [56137] (1 species) CMGC group; ERK/MAPK subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56138] (50 PDB entries) |
Domain d2excx_: 2exc X: [132523] automated match to d1jnk__ complexed with jnk |
PDB Entry: 2exc (more details), 2.75 Å
SCOPe Domain Sequences for d2excx_:
Sequence, based on SEQRES records: (download)
>d2excx_ d.144.1.7 (X:) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyv vtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcp efmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidp akrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmn
>d2excx_ d.144.1.7 (X:) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} dnqfysvevgdstftvlkryqnlkpigsgivcaaydavldrnvaikklsrpfqnqthakr ayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldherms yllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglavtryyrapevilgmgy kenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrnyven rpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqhpyin vwydpaeveapppqlderehtieewkeliykevmn
Timeline for d2excx_: