Lineage for d2exaa1 (2exa A:26-477)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883341Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 883342Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 883798Family e.3.1.3: Dac-like [144040] (3 proteins)
    Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family ((69501)) and (d2) six-stranded beta-sandwich with a crossed-loop topology
  6. 883813Protein DD-carboxypeptidase DacB [144045] (1 species)
    Penicillin-binding protein 4
  7. 883814Species Escherichia coli [TaxId:562] [144046] (6 PDB entries)
    Uniprot P24228 22-477
  8. 883819Domain d2exaa1: 2exa A:26-477 [132521]
    automatically matched to 2EX2 A:22-477
    complexed with fro, gol

Details for d2exaa1

PDB Entry: 2exa (more details), 1.7 Å

PDB Description: crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with farom
PDB Compounds: (A:) Penicillin-binding protein 4

SCOP Domain Sequences for d2exaa1:

Sequence, based on SEQRES records: (download)

>d2exaa1 e.3.1.3 (A:26-477) DD-carboxypeptidase DacB {Escherichia coli [TaxId: 562]}
yitqlpaganlalmvqkvgasapaidyhsqqmalpastqkvitalaaliqlgpdfrfttt
letkgnvengvlkgdlvarfgadptlkrqdirnmvatlkksgvnqidgnvlidtsifash
dkapgwpwndmtqcfsappaaaivdrncfsvslysapkpgdmafirvasyypvtmfsqvr
tlprgsaeaqyceldvvpgdlnrftltgclpqrseplplafavqdgasyagailkyelkq
agitwsgtllrqtqvnepgtvvaskqsaplhdllkimlkksdnmiadtvfrmigharfnv
pgtwragsdavrqilrqqagvdigntiiadgsglsrhnliapatmmqvlqyiaqhdneln
fismlplagydgslqyraglhqagvdgkvsaktgslqgvynlagfittasgqrmafvqyl
sgyavepadqrnrriplvrfesrlykdiyqnn

Sequence, based on observed residues (ATOM records): (download)

>d2exaa1 e.3.1.3 (A:26-477) DD-carboxypeptidase DacB {Escherichia coli [TaxId: 562]}
yitqlpaganlalmvqkvgasapaidyhsqqmalpastqkvitalaaliqlgpdfrfttt
letkgnvengvlkgdlvarfgadptlkrqdirnmvatlkksgvnqidgnvlidtsifash
dkapgwpwndmtqcfsappaaaivdrncfsvslysapkpgdmafirvasyypvtmfsqvr
tlprgsaeaqyceldvvpgdlnrftltgclpqrseplplafavqdgasyagailkyelkq
agitwsgtllrqtqvnepgtvvaskqsaplhdllkimlkksdnmiadtvfrmigharfnv
pgtwragsdavrqilrqqagvdigntiiadgsglsrhnliapatmmqvlqyiaqhdneln
fismlplagydgslqyraglhqagvdgkvsaktgslqgvynlagfittasgqrmafvqyl
sgyariplvrfesrlykdiyqnn

SCOP Domain Coordinates for d2exaa1:

Click to download the PDB-style file with coordinates for d2exaa1.
(The format of our PDB-style files is described here.)

Timeline for d2exaa1: