Lineage for d2ex8a_ (2ex8 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014028Family e.3.1.3: Dac-like [144040] (3 proteins)
    Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology
  6. 3014107Protein DD-carboxypeptidase DacB [144045] (2 species)
    Penicillin-binding protein 4
  7. 3014108Species Escherichia coli [TaxId:562] [144046] (6 PDB entries)
    Uniprot P24228 22-477
  8. 3014110Domain d2ex8a_: 2ex8 A: [132519]
    automated match to d2ex2a1
    complexed with pnm

Details for d2ex8a_

PDB Entry: 2ex8 (more details), 1.6 Å

PDB Description: crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with penicillin-g
PDB Compounds: (A:) Penicillin-binding protein 4

SCOPe Domain Sequences for d2ex8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ex8a_ e.3.1.3 (A:) DD-carboxypeptidase DacB {Escherichia coli [TaxId: 562]}
nvdeyitqlpaganlalmvqkvgasapaidyhsqqmalpastqkvitalaaliqlgpdfr
ftttletkgnvengvlkgdlvarfgadptlkrqdirnmvatlkksgvnqidgnvlidtsi
fashdkapgwpwndmtqcfsappaaaivdrncfsvslysapkpgdmafirvasyypvtmf
sqvrtlprgsaeaqyceldvvpgdlnrftltgclpqrseplplafavqdgasyagailky
elkqagitwsgtllrqtqvnepgtvvaskqsaplhdllkimlkksdnmiadtvfrmigha
rfnvpgtwragsdavrqilrqqagvdigntiiadgsglsrhnliapatmmqvlqyiaqhd
nelnfismlplagydgslqyraglhqagvdgkvsaktgslqgvynlagfittasgqrmaf
vqylsgyavepadqrnrriplvrfesrlykdiyqnn

SCOPe Domain Coordinates for d2ex8a_:

Click to download the PDB-style file with coordinates for d2ex8a_.
(The format of our PDB-style files is described here.)

Timeline for d2ex8a_: