SCOPe 2.08: Domain d2ex6a_: 2ex6 A:

Lineage for d2ex6a_ (2ex6 A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.3: Dac-like [144040] (3 proteins)
   Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology

6. Protein DD-carboxypeptidase DacB [144045] (2 species)
   Penicillin-binding protein 4

7. Species Escherichia coli [TaxId:562] [144046] (6 PDB entries)
   Uniprot P24228 22-477

8. Domain d2ex6a_: 2ex6 A: [132518]
   automated match to d2ex2a1
   complexed with aix, gol

Details for d2ex6a_

PDB Entry: 2ex6, 1.6 Å

PDB Description: crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with ampicillin

PDB Compounds: (A:) Penicillin-binding protein 4

SCOPe Domain Sequences for d2ex6a_:

Sequence; same for both SEQRES and ATOM records:

>d2ex6a_ e.3.1.3 (A:) DD-carboxypeptidase DacB {Escherichia coli [TaxId: 562]}
tqlpaganlalmvqkvgasapaidyhsqqmalpastqkvitalaaliqlgpdfrftttle
tkgnvengvlkgdlvarfgadptlkrqdirnmvatlkksgvnqidgnvlidtsifashdk
apgwpwndmtqcfsappaaaivdrncfsvslysapkpgdmafirvasyypvtmfsqvrtl
prgsaeaqyceldvvpgdlnrftltgclpqrseplplafavqdgasyagailkyelkqag
itwsgtllrqtqvnepgtvvaskqsaplhdllkimlkksdnmiadtvfrmigharfnvpg
twragsdavrqilrqqagvdigntiiadgsglsrhnliapatmmqvlqyiaqhdnelnfi
smlplagydgslqyraglhqagvdgkvsaktgslqgvynlagfittasgqrmafvqylsg
yavepadqrnrriplvrfesrlykdiyqnn

Timeline for d2ex6a_:

• d2ex6a_ first appeared in SCOP 1.73, called d2ex6a1
  
• d2ex6a_ appears in SCOPe 2.07