SCOP 1.75: Domain d2ex3k2: 2ex3 K:188-575

Lineage for d2ex3k2 (2ex3 K:188-575)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (4 proteins)

6. Protein phi29 DNA polymerase [118193] (1 species)

7. Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries)
   Uniprot P03680

8. Domain d2ex3k2: 2ex3 K:188-575 [132514]
   Other proteins in same PDB: d2ex3a1, d2ex3b1, d2ex3c1, d2ex3d1, d2ex3e1, d2ex3f1, d2ex3g1, d2ex3h1, d2ex3i1, d2ex3j1, d2ex3k1, d2ex3l1
   automatically matched to 2EX3 A:188-575
   complexed with pb; mutant

Details for d2ex3k2

PDB Entry: 2ex3, 3 Å

PDB Description: bacteriophage phi29 dna polymerase bound to terminal protein

PDB Compounds: (K:) DNA polymerase

SCOP Domain Sequences for d2ex3k2:

Sequence; same for both SEQRES and ATOM records:

>d2ex3k2 e.8.1.1 (K:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv
fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs
rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw
tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt
pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes
tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk
vgfsrkmkpkpvqvpggvvlvddtftik

Timeline for d2ex3k2:

• d2ex3k2 first appeared in SCOP 1.73
  
• d2ex3k2 appears in SCOPe 2.01
  
• d2ex3k2 appears in the current release, SCOPe 2.08