Lineage for d2ex3k2 (2ex3 K:188-575)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016466Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3016714Protein phi29 DNA polymerase [118193] (1 species)
  7. 3016715Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries)
    Uniprot P03680
  8. 3016740Domain d2ex3k2: 2ex3 K:188-575 [132514]
    Other proteins in same PDB: d2ex3a1, d2ex3b1, d2ex3c1, d2ex3d1, d2ex3e1, d2ex3f1, d2ex3g1, d2ex3h1, d2ex3i1, d2ex3j1, d2ex3k1, d2ex3l1
    automated match to d2py5a2
    protein/DNA complex; complexed with pb

Details for d2ex3k2

PDB Entry: 2ex3 (more details), 3 Å

PDB Description: bacteriophage phi29 dna polymerase bound to terminal protein
PDB Compounds: (K:) DNA polymerase

SCOPe Domain Sequences for d2ex3k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ex3k2 e.8.1.1 (K:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv
fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs
rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw
tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt
pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes
tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk
vgfsrkmkpkpvqvpggvvlvddtftik

SCOPe Domain Coordinates for d2ex3k2:

Click to download the PDB-style file with coordinates for d2ex3k2.
(The format of our PDB-style files is described here.)

Timeline for d2ex3k2: