Lineage for d2ex3k1 (2ex3 K:6-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886652Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)
  7. 2886653Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries)
    Uniprot P03680
  8. 2886678Domain d2ex3k1: 2ex3 K:6-187 [132513]
    Other proteins in same PDB: d2ex3a2, d2ex3b1, d2ex3c2, d2ex3d1, d2ex3e2, d2ex3f1, d2ex3g2, d2ex3h1, d2ex3i2, d2ex3j1, d2ex3k2, d2ex3l1
    automated match to d2py5a1
    protein/DNA complex; complexed with pb

Details for d2ex3k1

PDB Entry: 2ex3 (more details), 3 Å

PDB Description: bacteriophage phi29 dna polymerase bound to terminal protein
PDB Compounds: (K:) DNA polymerase

SCOPe Domain Sequences for d2ex3k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ex3k1 c.55.3.5 (K:6-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
rkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlkf
agafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslkk
lpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqgl
dr

SCOPe Domain Coordinates for d2ex3k1:

Click to download the PDB-style file with coordinates for d2ex3k1.
(The format of our PDB-style files is described here.)

Timeline for d2ex3k1: