Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins) contains Pfam PF00929 |
Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species) |
Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries) Uniprot P03680 |
Domain d2ex3e1: 2ex3 E:6-187 [132504] Other proteins in same PDB: d2ex3a2, d2ex3b1, d2ex3c2, d2ex3d1, d2ex3e2, d2ex3f1, d2ex3g2, d2ex3h1, d2ex3i2, d2ex3j1, d2ex3k2, d2ex3l1 automatically matched to 2EX3 A:6-187 complexed with pb; mutant |
PDB Entry: 2ex3 (more details), 3 Å
SCOP Domain Sequences for d2ex3e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ex3e1 c.55.3.5 (E:6-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} rkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlkf agafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslkk lpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqgl dr
Timeline for d2ex3e1: