SCOPe 2.08: Domain d2ex3c2: 2ex3 C:188-575

Lineage for d2ex3c2 (2ex3 C:188-575)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein phi29 DNA polymerase [118193] (1 species)

7. Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries)
   Uniprot P03680

8. Domain d2ex3c2: 2ex3 C:188-575 [132502]
   Other proteins in same PDB: d2ex3a1, d2ex3b1, d2ex3c1, d2ex3d1, d2ex3e1, d2ex3f1, d2ex3g1, d2ex3h1, d2ex3i1, d2ex3j1, d2ex3k1, d2ex3l1
   automated match to d2py5a2
   protein/DNA complex; complexed with pb

Details for d2ex3c2

PDB Entry: 2ex3, 3 Å

PDB Description: bacteriophage phi29 dna polymerase bound to terminal protein

PDB Compounds: (C:) DNA polymerase

SCOPe Domain Sequences for d2ex3c2:

Sequence; same for both SEQRES and ATOM records:

>d2ex3c2 e.8.1.1 (C:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv
fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs
rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw
tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt
pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes
tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk
vgfsrkmkpkpvqvpggvvlvddtftik

Timeline for d2ex3c2:

• d2ex3c2 first appeared in SCOP 1.73
  
• d2ex3c2 appears in SCOPe 2.07