SCOP 1.73: Domain d2ex3c1: 2ex3 C:6-187

Lineage for d2ex3c1 (2ex3 C:6-187)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)

7. Species Bacteriophage phi-29 [TaxId:10756] [117651] (4 PDB entries)

8. Domain d2ex3c1: 2ex3 C:6-187 [132501]
   Other proteins in same PDB: d2ex3a2, d2ex3b1, d2ex3c2, d2ex3d1, d2ex3e2, d2ex3f1, d2ex3g2, d2ex3h1, d2ex3i2, d2ex3j1, d2ex3k2, d2ex3l1
   automatically matched to 2EX3 A:6-187
   complexed with pb; mutant

Details for d2ex3c1

PDB Entry: 2ex3, 3 Å

PDB Description: bacteriophage phi29 dna polymerase bound to terminal protein

PDB Compounds: (C:) DNA polymerase

SCOP Domain Sequences for d2ex3c1:

Sequence; same for both SEQRES and ATOM records:

>d2ex3c1 c.55.3.5 (C:6-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
rkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlkf
agafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslkk
lpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqgl
dr

Timeline for d2ex3c1:

• d2ex3c1 is new in SCOP 1.73
  
• d2ex3c1 appears in SCOP 1.75
  
• d2ex3c1 appears in the current release, SCOPe 2.08