Lineage for d2ewoi2 (2ewo I:2-369)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537906Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2537907Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2538050Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2538051Protein automated matches [190175] (9 species)
    not a true protein
  7. 2538118Species Streptococcus mutans [TaxId:1309] [187074] (1 PDB entry)
  8. 2538126Domain d2ewoi2: 2ewo I:2-369 [132484]
    Other proteins in same PDB: d2ewoa1, d2ewoa2, d2ewob3, d2ewoc3, d2ewod3, d2ewoe3, d2ewof3, d2ewog3, d2ewoh3, d2ewoi3, d2ewoj3, d2ewok3, d2ewol3
    automated match to d1vkpa_

Details for d2ewoi2

PDB Entry: 2ewo (more details), 2.9 Å

PDB Description: X-ray structure of putative agmatine deiminase Q8DW17, Northeast Structural Genomics target SmR6.
PDB Compounds: (I:) Putative agmatine deiminase

SCOPe Domain Sequences for d2ewoi2:

Sequence, based on SEQRES records: (download)

>d2ewoi2 d.126.1.0 (I:2-369) automated matches {Streptococcus mutans [TaxId: 1309]}
akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipreeg
emaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihc
itqqqpat

Sequence, based on observed residues (ATOM records): (download)

>d2ewoi2 d.126.1.0 (I:2-369) automated matches {Streptococcus mutans [TaxId: 1309]}
akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
t

SCOPe Domain Coordinates for d2ewoi2:

Click to download the PDB-style file with coordinates for d2ewoi2.
(The format of our PDB-style files is described here.)

Timeline for d2ewoi2: