Lineage for d2ewog_ (2ewo G:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668076Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1668077Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1668203Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 1668204Protein automated matches [190175] (6 species)
    not a true protein
  7. 1668242Species Streptococcus mutans [TaxId:1309] [187074] (1 PDB entry)
  8. 1668248Domain d2ewog_: 2ewo G: [132482]
    Other proteins in same PDB: d2ewoa1
    automated match to d1vkpa_

Details for d2ewog_

PDB Entry: 2ewo (more details), 2.9 Å

PDB Description: X-ray structure of putative agmatine deiminase Q8DW17, Northeast Structural Genomics target SmR6.
PDB Compounds: (G:) Putative agmatine deiminase

SCOPe Domain Sequences for d2ewog_:

Sequence, based on SEQRES records: (download)

>d2ewog_ d.126.1.0 (G:) automated matches {Streptococcus mutans [TaxId: 1309]}
akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipreeg
emaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihc
itqqqpatl

Sequence, based on observed residues (ATOM records): (download)

>d2ewog_ d.126.1.0 (G:) automated matches {Streptococcus mutans [TaxId: 1309]}
akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
tl

SCOPe Domain Coordinates for d2ewog_:

Click to download the PDB-style file with coordinates for d2ewog_.
(The format of our PDB-style files is described here.)

Timeline for d2ewog_: