Lineage for d2ewoa1 (2ewo A:2-370)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668076Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1668077Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1668154Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. 1668155Protein Agmatine iminohydrolase [111156] (3 species)
  7. 1668165Species Streptococcus mutans [TaxId:1309] [143807] (1 PDB entry)
    Uniprot Q8DW17 2-370
  8. 1668166Domain d2ewoa1: 2ewo A:2-370 [132476]
    Other proteins in same PDB: d2ewob_, d2ewoc_, d2ewod_, d2ewoe_, d2ewof_, d2ewog_, d2ewoh_, d2ewoi_, d2ewoj_, d2ewok_, d2ewol_

Details for d2ewoa1

PDB Entry: 2ewo (more details), 2.9 Å

PDB Description: X-ray structure of putative agmatine deiminase Q8DW17, Northeast Structural Genomics target SmR6.
PDB Compounds: (A:) Putative agmatine deiminase

SCOPe Domain Sequences for d2ewoa1:

Sequence, based on SEQRES records: (download)

>d2ewoa1 d.126.1.6 (A:2-370) Agmatine iminohydrolase {Streptococcus mutans [TaxId: 1309]}
akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipreeg
emaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihc
itqqqpatl

Sequence, based on observed residues (ATOM records): (download)

>d2ewoa1 d.126.1.6 (A:2-370) Agmatine iminohydrolase {Streptococcus mutans [TaxId: 1309]}
akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
tl

SCOPe Domain Coordinates for d2ewoa1:

Click to download the PDB-style file with coordinates for d2ewoa1.
(The format of our PDB-style files is described here.)

Timeline for d2ewoa1: