Lineage for d2ewoa1 (2ewo A:2-369)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. Protein Agmatine iminohydrolase [111156] (3 species)
  7. Species Streptococcus mutans [TaxId:1309] [143807] (1 PDB entry)
    Uniprot Q8DW17 2-370
  8. Domain d2ewoa1: 2ewo A:2-369 [132476]
    Other proteins in same PDB: d2ewoa2, d2ewob2, d2ewob3, d2ewoc2, d2ewoc3, d2ewod2, d2ewod3, d2ewoe2, d2ewoe3, d2ewof2, d2ewof3, d2ewog2, d2ewog3, d2ewoh2, d2ewoh3, d2ewoi2, d2ewoi3, d2ewoj2, d2ewoj3, d2ewok2, d2ewok3, d2ewol2, d2ewol3

Details for d2ewoa1

PDB Entry: 2ewo (more details), 2.9 Å

PDB Description: X-ray structure of putative agmatine deiminase Q8DW17, Northeast Structural Genomics target SmR6.
PDB Compounds: (A:) Putative agmatine deiminase

SCOPe Domain Sequences for d2ewoa1:

Sequence, based on SEQRES records: (download)

>d2ewoa1 d.126.1.6 (A:2-369) Agmatine iminohydrolase {Streptococcus mutans [TaxId: 1309]}
akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipreeg
emaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihc
itqqqpat

Sequence, based on observed residues (ATOM records): (download)

>d2ewoa1 d.126.1.6 (A:2-369) Agmatine iminohydrolase {Streptococcus mutans [TaxId: 1309]}
akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegemaiasy
lnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihcitqqqpa
t

SCOPe Domain Coordinates for d2ewoa1 are not available.

Timeline for d2ewoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ewoa2