Lineage for d2ewnb3 (2ewn B:64-270)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426347Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1426348Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1426598Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins)
  6. 1426599Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species)
    this structure contains an SH2-like fold
  7. 1426600Species Escherichia coli [TaxId:562] [55709] (4 PDB entries)
  8. 1426606Domain d2ewnb3: 2ewn B:64-270 [132475]
    Other proteins in same PDB: d2ewna1, d2ewna2, d2ewnb1, d2ewnb2
    automated match to d1biaa3
    complexed with btx

Details for d2ewnb3

PDB Entry: 2ewn (more details), 2.8 Å

PDB Description: Ecoli Biotin Repressor with co-repressor analog
PDB Compounds: (B:) BirA BIFUNCTIONAL PROTEIN

SCOPe Domain Sequences for d2ewnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewnb3 d.104.1.2 (B:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli
relraalelfeqeglapylsrwekldn

SCOPe Domain Coordinates for d2ewnb3:

Click to download the PDB-style file with coordinates for d2ewnb3.
(The format of our PDB-style files is described here.)

Timeline for d2ewnb3: