Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins) |
Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species) this structure contains an SH2-like fold |
Species Escherichia coli [TaxId:562] [55709] (4 PDB entries) |
Domain d2ewnb3: 2ewn B:64-270 [132475] Other proteins in same PDB: d2ewna1, d2ewna2, d2ewnb1, d2ewnb2 automated match to d1biaa3 complexed with btx |
PDB Entry: 2ewn (more details), 2.8 Å
SCOPe Domain Sequences for d2ewnb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewnb3 d.104.1.2 (B:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]} iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli relraalelfeqeglapylsrwekldn
Timeline for d2ewnb3: