![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) ![]() the N-terminal domains of these repressors bind DNA |
![]() | Family b.34.1.1: Biotin repressor (BirA) [50038] (2 proteins) automatically mapped to Pfam PF02237 |
![]() | Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [50040] (4 PDB entries) |
![]() | Domain d2ewnb2: 2ewn B:271-318 [132474] Other proteins in same PDB: d2ewna1, d2ewna3, d2ewnb1, d2ewnb3 automated match to d1biaa2 complexed with btx |
PDB Entry: 2ewn (more details), 2.8 Å
SCOPe Domain Sequences for d2ewnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewnb2 b.34.1.1 (B:271-318) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislrs
Timeline for d2ewnb2: