Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) the N-terminal domains of these repressors bind DNA |
Family b.34.1.1: Biotin repressor (BirA) [50038] (2 proteins) |
Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species) |
Species Escherichia coli [TaxId:562] [50040] (4 PDB entries) |
Domain d2ewnb2: 2ewn B:271-317 [132474] Other proteins in same PDB: d2ewna1, d2ewna3, d2ewnb1, d2ewnb3 automatically matched to d1bia_2 complexed with btx |
PDB Entry: 2ewn (more details), 2.8 Å
SCOP Domain Sequences for d2ewnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewnb2 b.34.1.1 (B:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr
Timeline for d2ewnb2: