Lineage for d2ewnb2 (2ewn B:271-318)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. Family b.34.1.1: Biotin repressor (BirA) [50038] (2 proteins)
    automatically mapped to Pfam PF02237
  6. Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)
  7. Species Escherichia coli [TaxId:562] [50040] (4 PDB entries)
  8. Domain d2ewnb2: 2ewn B:271-318 [132474]
    Other proteins in same PDB: d2ewna1, d2ewna3, d2ewnb1, d2ewnb3
    automated match to d1biaa2
    complexed with btx

Details for d2ewnb2

PDB Entry: 2ewn (more details), 2.8 Å

PDB Description: Ecoli Biotin Repressor with co-repressor analog
PDB Compounds: (B:) BirA BIFUNCTIONAL PROTEIN

SCOPe Domain Sequences for d2ewnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewnb2 b.34.1.1 (B:271-318) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislrs

SCOPe Domain Coordinates for d2ewnb2 are not available.

Timeline for d2ewnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ewnb1, d2ewnb3
View in 3D
Domains from other chains:
(mouse over for more information)
d2ewna1, d2ewna2, d2ewna3