SCOPe 2.08: Domain d2ewnb1: 2ewn B:2-63

Lineage for d2ewnb1 (2ewn B:2-63)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.1: Biotin repressor-like [46786] (2 proteins)
   automatically mapped to Pfam PF08279

6. Protein Biotin repressor, N-terminal domain [46787] (1 species)
   the middle domain is an alpha+beta fold somewhat similar to the SH2 fold
   C-terminal domain has SH3-like common fold

7. Species Escherichia coli [TaxId:562] [46788] (4 PDB entries)

8. Domain d2ewnb1: 2ewn B:2-63 [132473]
   Other proteins in same PDB: d2ewna2, d2ewna3, d2ewnb2, d2ewnb3
   automated match to d1biaa1
   complexed with btx

Details for d2ewnb1

PDB Entry: 2ewn, 2.8 Å

PDB Description: Ecoli Biotin Repressor with co-repressor analog

PDB Compounds: (B:) BirA BIFUNCTIONAL PROTEIN

SCOPe Domain Sequences for d2ewnb1:

Sequence; same for both SEQRES and ATOM records:

>d2ewnb1 a.4.5.1 (B:2-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]}
kdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslp
ep

Timeline for d2ewnb1:

• d2ewnb1 first appeared in SCOP 1.73
  
• d2ewnb1 appears in SCOPe 2.07