Lineage for d2ewna3 (2ewn A:64-270)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214435Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1214436Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 1214654Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins)
  6. 1214655Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species)
    this structure contains an SH2-like fold
  7. 1214656Species Escherichia coli [TaxId:562] [55709] (4 PDB entries)
  8. 1214661Domain d2ewna3: 2ewn A:64-270 [132472]
    Other proteins in same PDB: d2ewna1, d2ewna2, d2ewnb1, d2ewnb2
    automatically matched to d1bia_3
    complexed with btx

Details for d2ewna3

PDB Entry: 2ewn (more details), 2.8 Å

PDB Description: Ecoli Biotin Repressor with co-repressor analog
PDB Compounds: (A:) BirA BIFUNCTIONAL PROTEIN

SCOPe Domain Sequences for d2ewna3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewna3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli
relraalelfeqeglapylsrwekldn

SCOPe Domain Coordinates for d2ewna3:

Click to download the PDB-style file with coordinates for d2ewna3.
(The format of our PDB-style files is described here.)

Timeline for d2ewna3: