![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families) ![]() |
![]() | Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins) |
![]() | Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species) this structure contains an SH2-like fold |
![]() | Species Escherichia coli [TaxId:562] [55709] (4 PDB entries) |
![]() | Domain d2ewna3: 2ewn A:64-270 [132472] Other proteins in same PDB: d2ewna1, d2ewna2, d2ewnb1, d2ewnb2 automatically matched to d1bia_3 complexed with btx |
PDB Entry: 2ewn (more details), 2.8 Å
SCOP Domain Sequences for d2ewna3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewna3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]} iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli relraalelfeqeglapylsrwekldn
Timeline for d2ewna3: